Serving Australia and NZ
1300 543 373
Return to Previous Page

ACBD4 Antibody

ACBD4 Antibody

Quick Overview:

Mouse anti Human ACBD4

Product Code: H00079777-B01P

  • Details

    Mouse anti Human ACBD4.
    Presentation: Purified
    Product is tested for ELISA (detection), Western blot / Immunoblot.
  • Additional Information

    SKU H00079777-B01P
    Name ACBD4 Antibody
    Size 50 µg
    Product Type Antibodies
    Target ACBD4
    Alternative target names HMFT0700
    Datasheet View Datasheet
    Storage In 1x PBS, pH 7.2
    AA Sequence MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSL GKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAV SEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQE LDVWLLGTVRALQESMQEVQARVQSLESMPRPPEQRPQPRPSARPWPLGLPGPALLFFLLWPFVVQWLFRMFRTQK R
    Presentation Purified
    Clonality Polyclonal
    Applications E(detection), WB
    Genename 79777
    Remarks Gene Accession: NM_024722
    Application Det Ab,WB-Tr
    Add. information Mouse polyclonal antibody raised against a full-length human ACBD4 protein.

    Antibody reactive against mammalian transfected lysate.
    State Purified
    Species Human
    Purity Purified
    UniProt Accession Number Q8NC06
    Purification Purified
    Buffer System In 1x PBS, pH 7.2
    Label None
    Supplier Abnova
    Species Human
    Host species Mouse
    Immunogen ACBD4 (NP_078998, 1 a.a. ~ 305 a.a) full-length human protein.
  • Images