Serving Australia and NZ
1300 543 373
Return to Previous Page

ACP5 / TR-AP Antibody

ACP5 / TR-AP Antibody

Quick Overview:

Mouse anti Human ACP5 / TR-AP

Product Code: H00000054-A01

  • Details

    Mouse anti Human ACP5 / TR-AP.
    Presentation: Serum
    Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.
  • Additional Information

    SKU H00000054-A01
    Name ACP5 / TR-AP Antibody
    Size 50 µl
    Product Type Antibodies
    Target ACP5 / TR-AP
    Alternative target names Tartrate-resistant acid phosphatase type 5, TRAP5, TRAcP
    Datasheet View Datasheet
    Storage 50 % glycerol
    AA Sequence VKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLRFHYGTEDSLGGFAYVE ISSKEMTVTYIEASGKSLFKTRLPRRARP*
    Presentation Serum
    Clonality Polyclonal
    Applications E, WB
    Genename 54
    Remarks Gene Accession: NM_001611
    Application ELISA,WB-Re
    Add. information Mouse polyclonal antibody raised against a partial recombinant ACP5.

    Antibody Reactive Against Recombinant Protein.
    State Serum
    Species Human
    Purity Serum
    UniProt Accession Number P13686
    Purification Serum
    Buffer System 50 % glycerol
    Label None
    Supplier Abnova
    Species Human
    Host species Mouse
    Immunogen ACP5 (NP_001602, 221 a.a. ~ 326 a.a) partial recombinant protein with GST tag.