Serving Australia and NZ
1300 543 373
Return to Previous Page

ACP6 / LPAP Antibody

ACP6 / LPAP Antibody

Quick Overview:

Rabbit anti Human, Mouse ACP6 / LPAP

Product Code: H00051205-D01P

  • Details

    Rabbit anti Human, Mouse ACP6 / LPAP.
    Presentation: Purified
    Product is tested for ELISA (detection), Western blot / Immunoblot.
  • Additional Information

    SKU H00051205-D01P
    Name ACP6 / LPAP Antibody
    Size 0.1 mg
    Product Type Antibodies
    Target ACP6 / LPAP
    Alternative target names ACPL1, PACPL1
    Datasheet View Datasheet
    Storage In 1x PBS, pH 7.2
    AA Sequence MITGVFSMRLWTPVGVLTSLAYCLHQRRVALAELQEADGQCPVDRSLLKLKMVQVVFRHGARSPLKPLPLEEQVEW NPQLLEVPPQTQFDYTVTNLAGGPKPYSPYDSQYHETTLKGGMFAGQLTKVGMQQMFALGERLRKNYVEDIPFLSP TFNPQEVFIRSTNIFRNLESTRCLLAGLFQCQKEGPIIIHTDEADSEVLYPNYQSCWSLRQRTRGRRQTASLQPGI SEDLKKVKDRMGIDSSDKVDFFILLDNVAAEQAHNLPSCPMLKRFARMIEQRAVDTSLYILPKEDRESLQMAVGPF LHILESNLLKAMDSATAPDKIRKLYLYAAHDVTFIPLLMTLGIFDHKWPPFAVDLTMELYQHLESKEWFVQLYYHG KEQVPRGCPDGLCPLDMFLNAMSVYTLSPEKYHALCSQTQVMEVGNEE
    Presentation Purified
    Clonality Polyclonal
    Applications E(detection), WB
    Genename 51205
    Remarks Gene Accession: NM_016361.2
    Application Det Ab,WB-Ti,WB-Tr
    Add. information Rabbit polyclonal antibody raised against a full-length human ACP6 protein.

    Antibody reactive against mammalian transfected lysate.
    State Purified
    Species Human,Mouse
    Purity Purified
    UniProt Accession Number Q9NPH0
    Purification Purified
    Buffer System In 1x PBS, pH 7.2
    Label None
    Supplier Abnova
    Species Human, Mouse
    Host species Rabbit
    Immunogen ACP6 (NP_057445.2, 1 a.a. ~ 428 a.a) full-length human protein.
  • Images