Serving Australia and NZ
1300 543 373
Return to Previous Page

AKAP4 Antibody

AKAP4 Antibody

Quick Overview:

Mouse anti Human AKAP4

Product Code: H00008852-A01

  • Details

    Mouse anti Human AKAP4.
    Presentation: Serum
    Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.
  • Additional Information

    SKU H00008852-A01
    Name AKAP4 Antibody
    Size 50 µl
    Product Type Antibodies
    Target AKAP4
    Alternative target names AKAP82, PRKA4
    Datasheet View Datasheet
    Storage 50 % glycerol
    AA Sequence MMAYSDTTMMSDDIDWLRSHRGVCKVDLYNPEGQQDQDRKVICFVDVSTLNVEDKDYKDAASSSSEGNLNLGSLEE KEIIVIKDTEKKDQSKTEGSVCLF*
    Presentation Serum
    Clonality Polyclonal
    Applications E, WB
    Genename 8852
    Remarks Gene Accession: NM_003886
    Application ELISA,WB-Re
    Add. information Mouse polyclonal antibody raised against a partial recombinant AKAP4.

    Antibody Reactive Against Recombinant Protein.
    State Serum
    Species Human
    Purity Serum
    UniProt Accession Number Q5JQC9
    Purification Serum
    Buffer System 50 % glycerol
    Label None
    Supplier Abnova
    Species Human
    Host species Mouse
    Immunogen AKAP4 (NP_003877, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag.