Serving Australia and NZ
1300 543 373
Return to Previous Page

AKAP4 Antibody

AKAP4 Antibody

Quick Overview:

Mouse anti Human AKAP4 4C10

Product Code: H00008852-M02

  • Details

    Mouse anti Human AKAP4 4C10.
    Presentation: Purified
    Product is tested for Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.
  • Additional Information

    SKU H00008852-M02
    Name AKAP4 Antibody
    Size 0.1 mg
    Product Type Antibodies
    Target AKAP4
    Alternative target names AKAP82, PRKA4
    Datasheet View Datasheet
    Storage In 1x PBS, pH 7.2
    AA Sequence MMAYSDTTMMSDDIDWLRSHRGVCKVDLYNPEGQQDQDRKVICFVDVSTLNVEDKDYKDAASSSSEGNLNLGSLEE KEIIVIKDTEKKDQSKTEGSVCLF*
    Presentation Purified
    Clonality Monoclonal
    Applications E, P, WB
    Genename 8852
    Remarks Gene Accession: NM_003886
    Application ELISA,IHC-P,S-ELISA,WB-Re
    Add. information Mouse monoclonal antibody raised against a partial recombinant AKAP4.

    Antibody Reactive Against Recombinant Protein.
    State Purified
    Species Human
    Purity Purified
    UniProt Accession Number Q5JQC9
    Purification Purified
    Buffer System In 1x PBS, pH 7.2
    Label None
    Supplier Abnova
    Species Human
    Host species Mouse
    Clone 4C10
    Immunogen AKAP4 (NP_003877, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Images