Serving Australia and NZ
1300 543 373
Return to Previous Page

ALG5 / HSPC149 Antibody

ALG5 / HSPC149 Antibody

Quick Overview:

Mouse anti Human ALG5 / HSPC149

Product Code: H00029880-B01P

  • Details

    Mouse anti Human ALG5 / HSPC149.
    Presentation: Purified
    Product is tested for ELISA (detection), Western blot / Immunoblot.
  • Additional Information

    SKU H00029880-B01P
    Name ALG5 / HSPC149 Antibody
    Size 50 µg
    Product Type Antibodies
    Target ALG5 / HSPC149
    Alternative target names DolP-glucosyltransferase
    Datasheet View Datasheet
    Storage In 1x PBS, pH 7.2
    AA Sequence MAPLLLQLAVLGAALAAAALVLISIVAFTTATKMPALHRHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYNE EKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMGIF SSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSYFRTLLMYGFHFLVWFLCV KGIRDTQCGFKLFTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTEIEGSKLVPFWSWLQMGKDLL FIRLRYLTGAWRLEQTRKMN
    Presentation Purified
    Clonality Polyclonal
    Applications E(detection), WB
    Genename 29880
    Remarks Gene Accession: NM_013338.3
    Application Det Ab,WB-Tr
    Add. information Mouse polyclonal antibody raised against a full-length human ALG5 protein.

    Antibody reactive against mammalian transfected lysate.
    State Purified
    Species Human
    Purity Purified
    UniProt Accession Number Q9Y673
    Purification Purified
    Buffer System In 1x PBS, pH 7.2
    Label None
    Supplier Abnova
    Species Human
    Host species Mouse
    Immunogen ALG5 (NP_037470.1, 1 a.a. ~ 324 a.a) full-length human protein.
  • Images