Serving Australia and NZ
1300 543 373
Return to Previous Page

ABCA4 Antibody

ABCA4 Antibody

Quick Overview:

Mouse anti Human ABCA4

Product Code: H00000024-A01

  • Details

    Mouse anti Human ABCA4.
    Presentation: Serum
    Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.
  • Additional Information

    SKU H00000024-A01
    Name ABCA4 Antibody
    Size 50 µl
    Product Type Antibodies
    Target ABCA4
    Alternative target names ABCR, Stargardt disease protein
    Datasheet View Datasheet
    Storage 50 % glycerol
    AA Sequence PKDDLLPDLNPVEQFFQGNFPGSVQRERHYNMLQFQVSSSSLARIFQLLLSHKDSLLIEEYSVTQTTLDQVFVNFA KQQTESHDLPLHPRAAGASRQAQD*
    Presentation Serum
    Clonality Polyclonal
    Applications E, WB
    Genename 24
    Remarks Gene Accession: NM_000350
    Application ELISA,WB-Ce,WB-Re
    Add. information Mouse polyclonal antibody raised against a partial recombinant ABCA4.

    Antibody Reactive Against Recombinant Protein.
    State Serum
    Species Human
    Purity Serum
    UniProt Accession Number P78363
    Purification Serum
    Buffer System 50 % glycerol
    Label None
    Supplier Abnova
    Species Human
    Host species Mouse
    Immunogen ABCA4 (NP_000341, 2174 a.a. ~ 2274 a.a) partial recombinant protein with GST tag.
  • Images