Serving Australia and NZ
1300 543 373
Return to Previous Page

ABHD12 Antibody

ABHD12 Antibody

Quick Overview:

Mouse anti Human ABHD12

Product Code: H00026090-B01P

  • Details

    Mouse anti Human ABHD12.
    Presentation: Purified
    Product is tested for ELISA (detection), Western blot / Immunoblot.
  • Additional Information

    SKU H00026090-B01P
    Name ABHD12 Antibody
    Size 50 µg
    Product Type Antibodies
    Target ABHD12
    Alternative target names C20orf22
    Datasheet View Datasheet
    Storage In 1x PBS, pH 7.2
    AA Sequence MRKRTEPVALEHERCAAAGSSSSGSAAAALDADCRLKQNLRLTGPAAAEPRCAADAGMKRALGRRKGVWLRLRKIL FCVLGLYIAIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKKPQDQGLNHTCNYYLQPEEDVTIGVWHTVPAVWWKNA QGKDQMWYEDALASSHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVF DWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWFFLDP ITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRHKYIYKSPE LPRILRPQQGPGSSPDPSMWSELV
    Presentation Purified
    Clonality Polyclonal
    Applications E(detection), WB
    Genename 26090
    Remarks Gene Accession: NM_015600.3
    Application Det Ab,WB-Tr
    Add. information Mouse polyclonal antibody raised against a full-length human C20orf22 protein.

    Antibody reactive against mammalian transfected lysate.
    State Purified
    Species Human
    Purity Purified
    UniProt Accession Number Q8N2K0
    Purification Purified
    Buffer System In 1x PBS, pH 7.2
    Label None
    Supplier Abnova
    Species Human
    Host species Mouse
    Immunogen C20orf22 (NP_056415.1, 1 a.a. ~ 404 a.a) full-length human protein.
  • Images