Serving Australia and NZ
1300 543 373
Return to Previous Page

ADAM29 Antibody

ADAM29 Antibody

Quick Overview:

Mouse anti Human ADAM29 1F6

Product Code: H00011086-M01A

  • Details

    Mouse anti Human ADAM29 1F6.
    Presentation: Ascites
    Product is tested for Enzyme Immunoassay.
  • Additional Information

    SKU H00011086-M01A
    Name ADAM29 Antibody
    Size 0.2 ml
    Product Type Antibodies
    Target ADAM29
    Alternative target names CT73
    Datasheet View Datasheet
    Storage In ascites fluid
    AA Sequence GMNHDEDTCRCSQPRCIMHEGNPPITKFSNCSYGDFWEYTVERTKCLLETVHTKDIFNVK*
    Presentation Ascites
    Clonality Monoclonal
    Applications E
    Genename 11086
    Remarks Gene Accession: NM_014269
    Application ELISA
    Add. information Mouse monoclonal antibody raised against a partial recombinant ADAM29.

    Antibody Reactive Against Recombinant Protein.
    State Ascites
    Species Human
    Purity Ascites
    UniProt Accession Number Q9UKF5
    Purification Ascites
    Buffer System In ascites fluid
    Label None
    Supplier Abnova
    Species Human
    Host species Mouse
    Clone 1F6
    Immunogen ADAM29 (-, 339 a.a. ~ 399 a.a) partial recombinant protein with GST tag.