Serving Australia and NZ
1300 543 373
Return to Previous Page

ADAM29 Antibody

ADAM29 Antibody

Quick Overview:

Mouse anti Human ADAM29 3A6

Product Code: H00011086-M09

  • Details

    Mouse anti Human ADAM29 3A6.
    Presentation: Purified
    Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.
  • Additional Information

    SKU H00011086-M09
    Name ADAM29 Antibody
    Size 0.1 mg
    Product Type Antibodies
    Target ADAM29
    Alternative target names CT73
    Datasheet View Datasheet
    Storage In 1x PBS, pH 7.2
    AA Sequence GMNHDEDTCRCSQPRCIMHEGNPPITKFSNCSYGDFWEYTVERTKCLLETVHTKDIFNVK*
    Presentation Purified
    Clonality Monoclonal
    Applications E, WB
    Genename 11086
    Remarks Gene Accession: NM_014269
    Application ELISA,WB-Re
    Add. information Mouse monoclonal antibody raised against a partial recombinant ADAM29.

    Antibody Reactive Against Recombinant Protein.
    State Purified
    Species Human
    Purity Purified
    UniProt Accession Number Q9UKF5
    Purification Purified
    Buffer System In 1x PBS, pH 7.2
    Label None
    Supplier Abnova
    Species Human
    Host species Mouse
    Clone 3A6
    Immunogen ADAM29 (NP_055084, 339 a.a. ~ 399 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.