Serving Australia and NZ
1300 543 373
Return to Previous Page

AIF1L / C9orf58 Antibody

AIF1L / C9orf58 Antibody

Quick Overview:

Mouse anti Human AIF1L / C9orf58

Product Code: H00083543-B01P

  • Details

    Mouse anti Human AIF1L / C9orf58.
    Presentation: Purified
    Product is tested for ELISA (detection), Western blot / Immunoblot.
  • Additional Information

    SKU H00083543-B01P
    Name AIF1L / C9orf58 Antibody
    Size 50 µg
    Product Type Antibodies
    Target AIF1L / C9orf58
    Alternative target names Allograft inflammatory factor 1-like, IBA2
    Datasheet View Datasheet
    Storage In 1x PBS, pH 7.2
    AA Sequence MSGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMM EKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP
    Presentation Purified
    Clonality Polyclonal
    Applications E(detection), WB
    Genename 83543
    Remarks Gene Accession: NM_031426
    Application Det Ab,WB-Tr
    Add. information Mouse polyclonal antibody raised against a full-length human C9orf58 protein.

    Antibody reactive against mammalian transfected lysate.
    State Purified
    Species Human
    Purity Purified
    UniProt Accession Number Q9BQI0
    Purification Purified
    Buffer System In 1x PBS, pH 7.2
    Label None
    Supplier Abnova
    Species Human
    Host species Mouse
    Immunogen C9orf58 (NP_113614, 1 a.a. ~ 150 a.a) full-length human protein.
  • Images