Serving Australia and NZ
1300 543 373
Return to Previous Page

ALG1 / HMAT1 Antibody

ALG1 / HMAT1 Antibody

Quick Overview:

Mouse anti Human ALG1 / HMAT1

Product Code: H00056052-A01

  • Details

    Mouse anti Human ALG1 / HMAT1.
    Presentation: Serum
    Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.
  • Additional Information

    SKU H00056052-A01
    Name ALG1 / HMAT1 Antibody
    Size 50 µl
    Product Type Antibodies
    Target ALG1 / HMAT1
    Alternative target names HMT1, Mannosyltransferase-1, MT-1, hMat-1
    Datasheet View Datasheet
    Storage 50 % glycerol
    AA Sequence IDWHNYGYSIMGLVHGPNHPLVLLAKWYEKFFGRLSHLNLCVTNAMREDLADNWHIRAVTVYDKPASFFKETPLDL QHRLFMKLGSMHSPFRARSEPEDP*
    Presentation Serum
    Clonality Polyclonal
    Applications E, WB
    Genename 56052
    Remarks Gene Accession: NM_019109
    Application ELISA,WB-Ce,WB-Re
    Add. information Mouse polyclonal antibody raised against a partial recombinant ALG1.

    Antibody Reactive Against Recombinant Protein.
    State Serum
    Species Human
    Purity Serum
    UniProt Accession Number Q9BT22
    Purification Serum
    Buffer System 50 % glycerol
    Label None
    Supplier Abnova
    Species Human
    Host species Mouse
    Immunogen ALG1 (NP_061982, 154 a.a. ~ 254 a.a) partial recombinant protein with GST tag.
  • Images