Serving Australia and NZ
1300 543 373
Return to Previous Page

ALX3 Antibody

ALX3 Antibody

Quick Overview:

Mouse anti Human ALX3

Product Code: H00000257-A01

  • Details

    Mouse anti Human ALX3.
    Presentation: Serum
    Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.
  • Additional Information

    SKU H00000257-A01
    Name ALX3 Antibody
    Size 50 µl
    Product Type Antibodies
    Target ALX3
    Alternative target names Homeobox protein aristaless-like 3
    Datasheet View Datasheet
    Storage 50 % glycerol
    AA Sequence KSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKIQEGRNPFT AAYDISVLPRTDSHPQLQNSLWAG*
    Presentation Serum
    Clonality Polyclonal
    Applications E, WB
    Genename 257
    Remarks Gene Accession: NM_006492
    Application ELISA,WB-Re
    Add. information Mouse polyclonal antibody raised against a partial recombinant ALX3.

    Antibody Reactive Against Recombinant Protein.
    State Serum
    Species Human
    Purity Serum
    UniProt Accession Number O95076
    Purification Serum
    Buffer System 50 % glycerol
    Label None
    Supplier Abnova
    Species Human
    Host species Mouse
    Immunogen ALX3 (NP_006483, 150 a.a. ~ 250 a.a) partial recombinant protein with GST tag.