Serving Australia and NZ
1300 543 373
Return to Previous Page

DYNC1H1 Antibody

DYNC1H1 Antibody

Quick Overview:

Mouse anti Human DYNC1H1

Product Code: H00001778-A01

  • Details

    Mouse anti Human DYNC1H1.
    Properties: (cytoplasmic)
    Presentation: Serum
    Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.
  • Additional Information

    SKU H00001778-A01
    Name DYNC1H1 Antibody
    Size 50 µl
    Product Type Antibodies
    Target DYNC1H1
    Alternative target names Dynein heavy chain 1, DHC1, DNCH1, DNCL, DNECL, DYHC, KIAA0325
    Datasheet View Datasheet
    AA Sequence TSQGATLDACSFGVTGLKLQGATCNNNKLSLSNAISTALPLTQLRWVKQTNTEKKASVVTLPVYLNFTRADLIFTV DFEIATKEDPRSFYERGVAVLCTE
    Presentation Serum
    Property cytoplasmic
    Clonality Polyclonal
    Applications E, WB
    Genename 1778
    Remarks Gene Accession: BC021297
    Application ELISA,WB-Re
    Species Human
    Storage 50 % glycerol
    State Serum
    Add. information Mouse polyclonal antibody raised against a partial recombinant DNCH1.

    Antibody Reactive Against Recombinant Protein.
    Purity Serum
    UniProt Accession Number Q14204
    Purification Serum
    Buffer System 50 % glycerol
    Label None
    Supplier Abnova
    Species Human
    Host species Mouse
    Immunogen DNCH1 (AAH21297, 733 a.a. ~ 832 a.a) partial recombinant protein with GST tag.