Serving Australia and NZ
1300 543 373
Return to Previous Page

Pepsin Antibody

Pepsin Antibody

Quick Overview:

Rabbit anti Human Pepsin

Product Code: H00005222-D01P

  • Details

    Rabbit anti Human Pepsin.
    Properties: (PGA5)
    Presentation: Purified
    Product is tested for ELISA (detection), Western blot / Immunoblot.
  • Additional Information

    SKU H00005222-D01P
    Name Pepsin Antibody
    Size 0.1 mg
    Product Type Antibodies
    Target Pepsin
    Alternative target names Pepsin A, PGA, pepsinogen 3 group I, pepsinogen 4 group I, pepsinogen 5 group I, Pepsinogen A, PGA3, PGA4, PGA5
    Datasheet View Datasheet
    AA Sequence MKWLLLLGLVALSECIMYKVPLIRKKSLRRTLSERGLLKDFLKKHNLNPARKYFPQWEAPTLVDEQPLENYLDMEY FGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQ VGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDKSGSVVI FGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSD GDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNVPTESGELWILGDVFIRQYFTVFDRANN QVGLAPVA
    Presentation Purified
    Property PGA5
    Clonality Polyclonal
    Applications E(detection), WB
    Genename 643834
    Remarks Gene Accession: NM_014224.1
    Application Det Ab,WB-Ti,WB-Tr
    Species Human
    Storage In 1x PBS, pH 7.2
    State Purified
    Add. information Rabbit polyclonal antibody raised against a full-length human PGA5 protein.

    Antibody reactive against mammalian transfected lysate.
    Purity Purified
    UniProt Accession Number P00790
    Purification Purified
    Buffer System In 1x PBS, pH 7.2
    Label None
    Supplier Abnova
    Species Human
    Host species Rabbit
    Immunogen PGA5 (NP_055039.1, 1 a.a. ~ 388 a.a) full-length human protein.
  • Images