Serving Australia and NZ
1300 543 373
Return to Previous Page

Collagen type IX Antibody

Collagen type IX Antibody

Quick Overview:

Mouse anti Human Collagen type IX

Product Code: H00001297-A01

  • Details

    Mouse anti Human Collagen type IX.
    Properties: alpha 1 chain
    Presentation: Serum
    Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.
  • Additional Information

    SKU H00001297-A01
    Name Collagen type IX Antibody
    Size 50 µl
    Product Type Antibodies
    Target Collagen type IX
    Alternative target names COL9A1
    Datasheet View Datasheet
    AA Sequence AVKRRPRFPVNSNSNGGNELCPKIRIGQDDLPGFDLISQFQVDKAASRRAIQRVVGSATLQVAYKLGNNVDFRIPT RNLYPSGLPEEYSFLTTFRMTGSTLKKNWNIWQ*
    Presentation Serum
    Property alpha 1 chain
    Clonality Polyclonal
    Applications E, WB
    Genename 1297
    Remarks Gene Accession: NM_001851
    Application ELISA,WB-Re
    Species Human
    Storage 50 % glycerol
    State Serum
    Add. information Mouse polyclonal antibody raised against a partial recombinant COL9A1.

    Antibody Reactive Against Recombinant Protein.
    Purity Serum
    UniProt Accession Number P20849
    Purification Serum
    Buffer System 50 % glycerol
    Label None
    Supplier Abnova
    Species Human
    Host species Mouse
    Immunogen COL9A1 (NP_001842, 24 a.a. ~ 133 a.a) partial recombinant protein with GST tag.