Serving Australia and NZ
1300 543 373
Return to Previous Page

Collagen type IX Antibody

Collagen type IX Antibody

Quick Overview:

Rabbit anti Human Collagen type IX

Product Code: H00001297-D01P

  • Details

    Rabbit anti Human Collagen type IX.
    Properties: alpha 1 chain
    Presentation: Purified
    Product is tested for ELISA (detection), Western blot / Immunoblot.
  • Additional Information

    SKU H00001297-D01P
    Name Collagen type IX Antibody
    Size 0.1 mg
    Product Type Antibodies
    Target Collagen type IX
    Alternative target names COL9A1
    Datasheet View Datasheet
    AA Sequence MKTCWKIPVFFFVCSFLEPWASAAVKRRPRFPVNSNSNGGNELCPKIRIGQDDLPGFDLISQFQVDKAASRRAIQR VVGSATLQVAYKLGNNVDFRIPTRNLYPSGLPEEYSFLTTFRMTGSTLKKNWNIWQIQDSSGKEQVGIKINGQTQS VVFSYKGLDGSLQTAAFSNLSSLFDSQWHKIMIGVERSSATLFVDCNRIESLPIKPRGPIDIDGFAVLGKLADNPQ VSVPFELQWMLIHCDPLRPRRETCHELPARITPSQTTDERGPPGEQGPPGPPGPPGVPGIDGIDGDRGPKGPPGPP GPAGEPGKPGAPGKPGTPGADTSP
    Presentation Purified
    Property alpha 1 chain
    Clonality Polyclonal
    Applications E(detection), WB
    Genename 1297
    Remarks Gene Accession: BC015409.1
    Application Det Ab,WB-Tr
    Species Human
    Storage In 1x PBS, pH 7.2
    State Purified
    Add. information Rabbit polyclonal antibody raised against a full-length human COL9A1 protein.

    Antibody reactive against mammalian transfected lysate.
    Purity Purified
    UniProt Accession Number P20849
    Purification Purified
    Buffer System In 1x PBS, pH 7.2
    Label None
    Supplier Abnova
    Species Human
    Host species Rabbit
    Immunogen COL9A1 (AAH15409.1, 1 a.a. ~ 328 a.a) full-length human protein.
  • Images