Serving Australia and NZ
1300 543 373
Return to Previous Page

Collagen type IX Antibody

Collagen type IX Antibody

Quick Overview:

Mouse anti Human Collagen type IX 3H1

Product Code: H00001297-M07

  • Details

    Mouse anti Human Collagen type IX 3H1.
    Properties: alpha 1 chain
    Presentation: Purified
    Product is tested for Enzyme Immunoassay.
  • Additional Information

    SKU H00001297-M07
    Name Collagen type IX Antibody
    Size 0.1 mg
    Product Type Antibodies
    Target Collagen type IX
    Alternative target names COL9A1
    Datasheet View Datasheet
    Storage In 1x PBS, pH 7.2
    AA Sequence MKTCWKIPVFFFVCSFLEPWASAAVKRRPRFPVNSNSNGGNELCPKIRIGQDDLPGFDLISQFQVDKAASRRAIQR VVGSATLQVAYKLGNNVDFRIPTRNLYPSGLPEEYSFLTTFRMTGSTLKKNWNIWQIQDSSGKEQVGIKINGQTQS VVFSYKGLDGSLQTAAFSNLSSLFDSQWHKIMIGVERSSATLFVDCNRIESLPIKPRGPIDIDGFAVLGKLADNPQ VSVPFELQWMLIHCDPLRPRRETCHEL
    Presentation Purified
    Property alpha 1 chain
    Clonality Monoclonal
    Applications E
    Genename 1297
    Remarks Gene Accession: BC015409
    Application ELISA
    Add. information Mouse monoclonal antibody raised against a full-length recombinant COL9A1.

    Antibody Reactive Against Recombinant Protein.
    State Purified
    Species Human
    Purity Purified
    UniProt Accession Number P20849
    Purification Purified
    Buffer System In 1x PBS, pH 7.2
    Label None
    Supplier Abnova
    Species Human
    Host species Mouse
    Clone 3H1
    Immunogen COL9A1 (AAH15409, 1 a.a. ~ 329 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.