Serving Australia and NZ
1300 543 373
Return to Previous Page

Collagen type V Antibody

Collagen type V Antibody

Quick Overview:

Mouse anti Human Collagen type V 2F4

Product Code: H00001289-M01

  • Details

    Mouse anti Human Collagen type V 2F4.
    Properties: alpha 1 chain
    Presentation: Purified
    Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.
  • Additional Information

    SKU H00001289-M01
    Name Collagen type V Antibody
    Size 0.1 mg
    Product Type Antibodies
    Target Collagen type V
    Alternative target names COL5A1
    Datasheet View Datasheet
    Storage In 1x PBS, pH 7.2
    AA Sequence MGPPGPPGPRGPSGAPGADGPQGPPGGIGNPGAVGEKGEPGEAGEPGLPGEGGPPGPKGERGEKGESGPSGAAGPP GPKGPPGDDGPKGSPGPVGFPGDPGPPGEPGPAGQDGPPGDKGDDGEPGQTGSPGPTGEPGPSGPPGKRGPPGPAG PEGRQGEKGAKGEAGLEGPPGKTGPIGPQGAPGKPGPDGLRGIPGPVGEQGLPGSPGPDGPPGPMGPPGLPGLKGD SGPKGEKGHPGLIGLIGPPGEQGEKGD
    Presentation Purified
    Property alpha 1 chain
    Clonality Monoclonal
    Applications E, WB
    Genename 1289
    Remarks Gene Accession: BC008760
    Application ELISA,S-ELISA,WB-Ce,WB-Re
    Add. information Mouse monoclonal antibody raised against a full length recombinant COL5A1.

    Antibody Reactive Against Recombinant Protein.
    State Purified
    Species Human
    Purity Purified
    UniProt Accession Number P20908
    Purification Purified
    Buffer System In 1x PBS, pH 7.2
    Label None
    Supplier Abnova
    Species Human
    Host species Mouse
    Clone 2F4
    Immunogen COL5A1 (AAH08760, 1 a.a. ~ 592 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Images